DOI > 10.5291/ILL-DATA.8-02-699

This proposal is publicly available since 10/15/2019

Title

Investigating membrane protein insertion using neutron reflectivity

Abstract

Abstract is not yet public

Experimental Report

The experimental report is not available to download

Download Data

Please note that you will need to login with your ILL credentials to download the data.

Download Data

Data Citation

The recommended format for citing this dataset in a research publication is in the following format:

WATKINS Erik; ALCARAZ Jean Pierre; FRAGNETO Giovanna; MACCARINI Marco; MARTIN Donald and SORANZO Thomas. (2014). Investigating membrane protein insertion using neutron reflectivity. Institut Laue-Langevin (ILL) doi:10.5291/ILL-DATA.8-02-699

Cited by

This data has not been cited by any articles.

Metadata

Experiment Parameters

Sample Parameters

  • Formula

    • DMPC: 1,2-dimyristoyl-sn-glycero-3-phosphocholine
    • p7 protein: MSGSHHHHHHSSGIEGRGRLIKHMALENLVILNAASLAGTHGLVSFLVFFCFAWYLKGRWVPGAVYAFYGMWPLLLLLLALPQRAYA
    • POPC: 1-palmitoyl-2-oleoyl-sn-glycero-3-phosphocholine
    • POPG:1-palmitoyl-2-oleoyl-sn-glycero-3-phospho-(1'-rac-glycerol)
    • DMPE-PEG2k: 1,2-dimyristoyl-sn-glycero-3-phosphoethanolamine-N-[methoxy(polyethylene glycol)-2000]

Institut Laue-Langevin

Copyright © 2025

  • Access to data is governed by the ILL data policy.
  • ILL has partnered with DataCite as the registration agency for data persistent identifiers.